- Complement Component C1rLP Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-88314
- Unconjugated
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- C1RL1, C1RLP, C1r-LP, CLSPa
- This antibody was developed against Recombinant Protein corresponding to amino acids: NVLPVCLPDN ETLYRSGLLG YVSGFGMEMG WLTTELKYSR LPVAPREACN AWLQKRQRPE VFSDNMFCVG DETQ
- Human
- Complement Component C1rLP
- 0.1 ml
- complement C1r subcomponent like
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
NVLPVCLPDNETLYRSGLLGYVSGFGMEMGWLTTELKYSRLPVAPREACNAWLQKRQRPEVFSDNMFCVGDETQ
Specifications/Features
Available conjugates: Unconjugated